The short version of aseptic technique fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-09-25 and is reviewed periodically as new material appears.
Temperature logs and cold-chain documentation help identify excursions that may compromise a batch. Automated freezers, desiccant packs, and sealed containers limit moisture and frost accumulation. Aliquoting small portions before freezing reduces the number of times the main stock changes temperature. Labels should include peptide name, lot, concentration if known, solvent, and date prepared. Periodic analytical verification by high-performance liquid chromatography or mass spectrometry can detect degradation, truncation, or sequence errors that visual inspection cannot reveal.
Practical handling begins with an inventory record that links each vial to a lot number, synthesis date, and purity certificate. Before opening a container, allow it to equilibrate to room temperature to prevent condensation on the powder. Weighing or transferring should occur in a low-humidity environment using tools that minimize static and adsorption. Hygroscopic peptides may gain water quickly, changing mass and concentration estimates. Recording the container's initial mass and any visible changes supports later reconciliation of material.
Aseptic technique reduces microbial and particulate contamination when a peptide solution will be used in cell culture or other sensitive applications. Work in a clean area, use sterile containers and filtered tips, and avoid touching vial interiors. Preparing aliquots immediately after dissolution limits repeated temperature cycling, which is a common cause of aggregation and activity loss. Low-binding plastic tubes are preferred for peptides that adsorb to surfaces, especially hydrophobic or positively charged sequences. Labels should record identity, solvent, concentration, and preparation date so that later use can be traced.
Shipping and short-term transfer require attention to temperature control and physical stability. Frozen solutions are commonly sent on dry ice, while lyophilized powders may travel with gel packs or insulated packaging. Thawing should be done slowly on ice or in a refrigerator, not by vigorous heating, and the solution should be mixed gently before use. Temperature loggers can document excursions during transit, but their presence does not prove that a peptide remained stable. Analytical checks such as chromatography or mass spectrometry can verify identity and purity after storage or shipping.
| Property | Value | Notes |
|---|---|---|
| Container material | Glass or polypropylene | Glass is relatively inert but can adsorb; polypropylene may leach. |
| Headspace gas | Argon or nitrogen | Inert gas displaces oxygen for oxidation-prone sequences. |
| Equilibration before opening | 20–30 minutes at room temperature | Sealed vial warms gradually to reduce condensation. |
| Typical aliquot size | Small working portions | Limits repeated temperature cycling of the main stock. |
| Documentation fields | Lot, date, solvent, concentration | Supports traceability and degradation monitoring. |
Peptide handling begins with careful receipt and inventory. Containers should be inspected for damage, label information should match the certificate of analysis, and storage location should be recorded. Many lyophilized peptides are electrostatic and may cling to vial walls or weighing paper, which can complicate transfer. Allowing a cold vial to equilibrate to room temperature before opening reduces condensation on the contents. Clean tools, gloves, and a low-humidity workspace limit contamination and moisture exposure during manipulation.
Reconstitution is the process of dissolving a dried peptide in a suitable solvent. The choice of solvent depends on solubility, charge, and sequence; sterile water is common, while buffers or small amounts of organic solvent may be needed for hydrophobic peptides. Adding solvent gently down the vial wall and mixing by inversion or gentle swirling reduces foaming and shear. Vortexing or vigorous pipetting can denature some peptides or promote aggregation. The resulting solution should be visually inspected for particles, turbidity, and complete dissolution before use.
Temperature is a primary factor in peptide storage. Lower temperatures reduce molecular motion and slow degradation reactions, but freezing can concentrate solutes and promote aggregation. Lyophilized powders are commonly held at -20°C, whereas solutions are often kept at -80°C. Repeated freeze-thaw cycles are harmful because ice crystal formation and pH shifts can damage the peptide. The glass transition temperature of a lyophilized cake influences its stability; below this temperature, molecular mobility is restricted. For solutions, the choice between -20°C and -80°C depends on the peptide's sensitivity and the intended storage duration.
Moisture, oxygen, and light also affect peptide integrity. Lyophilized powders absorb water from the air, which can enable hydrolysis and conformational changes. Oxygen promotes oxidation of sensitive residues, so storage under inert gas or in sealed vials is common. Light exposure can cause photodegradation, particularly for peptides containing aromatic amino acids. Buffer choice and pH influence charge state and solubility; extremes of pH accelerate deamidation and hydrolysis. Adding stabilizers such as sugars or polyols can protect the peptide during freezing and drying. Optimal conditions are determined empirically for each peptide.
Peptides are short chains of amino acids that can undergo both chemical and physical degradation. Chemical pathways include hydrolysis of peptide bonds, oxidation of methionine or cysteine residues, deamidation of asparagine or glutamine, and isomerization of aspartate. Physical instability leads to aggregation, precipitation, or adsorption to surfaces. The rate of these processes depends on the peptide sequence, the formulation, and the storage environment. Because each peptide has a unique composition, no single storage condition applies to all peptides. Stability studies are therefore conducted to define suitable conditions for each specific molecule.
Cold-chain shipping uses insulated containers, phase-change packs, and temperature indicators. Dry ice maintains -70 °C or lower but requires venting to avoid pressure buildup. Gel packs provide 2-8 °C for shorter transit. Upon arrival, recipients should record temperature indicators and transfer vials promptly to storage. Deviations from specified conditions should be documented and may require analytical re-check. The effect of a brief temperature excursion is peptide-specific and not always predictable from general rules.
Handling begins with receipt and inspection. Vials should be checked for damage, label integrity, and temperature history. Lyophilized peptides should be allowed to equilibrate to room temperature before opening to prevent condensation. Solutions should be prepared in a clean, calibrated environment using appropriate solvents. Personal protective equipment and containment reduce exposure and contamination. Documentation of lot number, date, and storage location supports traceability. The goal is to limit repeated temperature changes, moisture exposure, and microbial contamination.
Reconstitution solvent depends on peptide solubility and intended use; water, buffer, or small amounts of organic solvent may be needed. After dissolution, solutions are typically aliquoted into single-use portions to avoid repeated freeze-thaw cycles. Aliquots are stored at -20 °C or -80 °C, depending on stability. Labels include concentration, solvent, date, and operator. Sterile filtration may be used when microbial control is required, but filters can adsorb peptides. The optimal concentration and solvent are often determined empirically.
In aqueous solution, peptides are vulnerable to hydrolysis, oxidation, deamidation, and aggregation, with rates influenced by pH, temperature, buffer composition, and ionic strength. Acidic or neutral pH ranges often slow deamidation, while extreme pH can accelerate peptide bond cleavage. Dissolved oxygen and redox-active metal ions contribute to oxidation of methionine, cysteine, and tryptophan residues. Aggregation may be driven by hydrophobic interactions or by interfaces such as air-liquid and container surfaces. Because these pathways interact, solution storage usually requires tighter control than storage of dried material.
Temperature is the most common controlled variable, but its effect is not linear. Lower temperatures reduce most chemical reaction rates, yet freezing can concentrate solutes and create pH shifts in the remaining liquid phase. Repeated freeze-thaw cycles can denature or aggregate some peptides, especially those with hydrophobic segments. For lyophilized powders, desiccation and protection from moisture are often more important than deep freezing. For solutions, the choice between refrigeration and freezing depends on peptide concentration, buffer components, and the intended duration of storage.
A balloon pops when the material that makes up its surface tears or shreds, creating a hole. Normally, there is a balance of the balloon skin's elastic tension in which every point on the balloon's surface is being pulled by the material surrounding it. However, if a hole is made on the balloon's surface, the force becomes imbalanced, since there is no longer any force exerted by the center of the hole on the material at its edge. As a result, the balloon's surface at the edge of the hole pulls away, making it bigger; the high pressure air can then escape through the hole and the balloon pops. A balloon can be popped by either physical or chemical actions. Limpanuparb et al. use popping a balloon as a demonstration to teach about physical and chemical hazards in laboratory safety.
PABA and its salts are used in nutritional epidemiological studies to assess the completeness of 24-hour urine collection for the determination of urinary sodium, potassium, or nitrogen levels. The potassium salt (potassium paraaminobenzoate, "aminobenzoate potassium") is used as a drug against fibrotic skin disorders, such as Peyronie's disease, under the brand name Potaba. There is a lack of strong evidence. It is believed to work by inhibiting fibroblast glycosaminoglycan secretion and stabilizing monoamine oxidase A activity. PABA is also occasionally used in pill form by sufferers of irritable bowel syndrome to treat its associated gastrointestinal symptoms. PABA derivatives have also been proposed to function as acetylcholinesterase inhibitors in diseases that cause deficient cholinergic systems, such as Alzheimer's disease.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Tight junctions are very important in embryo development. In the blastula, these cadherin mediated cell interactions are essential to development of epithelium which are most important to paracellular transport, maintenance of cell polarity and the creation of a permeability seal to regulate blastocoel formation. These tight junctions arise after the polarity of epithelial cells is established which sets the foundation for further development and specification. Within the blastula, inner blastomeres are generally non-polar while epithelial cells demonstrate polarity. Mammalian embryos undergo compaction around the 8-cell stage where E-cadherins as well as alpha and beta catenins are expressed. This process makes a ball of embryonic cells which are capable of interacting, rather than a group of diffuse and undifferentiated cells. E-cadherin adhesion defines the apico-basal axis in the developing embryo and turns the embryo from an indistinct ball of cells to a more polarized phenotype which sets the stage for further development into a fully formed blastocyst. Xenopus membrane polarity is established with the first cell cleavage. Amphibian EP-cadherin and XB/U cadherin perform a similar role as E-cadherin in mammals establishing blastomere polarity and solidifying cell-cell interactions which are crucial for further development.
Sources: en.wikipedia.org
The manifestation of apical dominance differs significantly between plant groups due to the positioning of their growing points (meristems): Broadleaf plants: The apical meristem is located at the shoot tip, elevated above the ground. Apical dominance is exerted downward, inhibiting axillary buds along the stem. Removing the apex (pruning) releases these buds, resulting in lateral branching and a bushier shape. Grasses: During vegetative growth, the primary apical meristem remains at or near the soil surface in a region called the crown. Growth occurs via intercalary meristems at the base of the leaves. Apical dominance in grasses primarily regulates tillering—the production of new shoots from basal buds. Because the meristem is protected at ground level, grasses can be mown or grazed without destroying the primary growing point, allowing them to recover more quickly than most broadleaf species. Plant physiologists have identified four different stages the plant goes through after the apex is removed (Stages I-IV). The four stages are referred to as:
Although they are classically thought of working only together, GPCRs may signal through G-protein-independent mechanisms, and heterotrimeric G-proteins may play functional roles independent of GPCRs. GPCRs may signal independently through many proteins already mentioned for their roles in G-protein-dependent signaling such as β-arrs, GRKs, and Srcs. Such signaling has been shown to be physiologically relevant, for example, β-arrestin signaling mediated by the chemokine receptor CXCR3 was necessary for full efficacy chemotaxis of activated T cells. In addition, further scaffolding proteins involved in subcellular localization of GPCRs (e.g., PDZ-domain-containing proteins) may also act as signal transducers. Most often the effector is a member of the MAPK family.
Back pressure is the term used for the hydraulic pressure required to create a flow through a chromatography column in high-performance liquid chromatography, the term deriving from the fact that it is generated by the resistance of the column, and exerts its influence backwards on the pump that must supply the flow. Back-pressure is a useful diagnostic feature of problems with the chromatography column. Rapid chromatography is favoured by columns packed with very small particles, which create high back-pressures. Column designers use "kinetic plots" to show the performance of a column at a constant back-pressure, usually selected as the maximum that a system's pump can reliably produce. Exhaust pulse pressure charging Expansion chamber Scalar quantity
Sources: en.wikipedia.org
Prolactin receptors are present in the mammillary glands, ovaries, pituitary glands, heart, lung, thymus, spleen, liver, pancreas, kidney, adrenal gland, uterus, skeletal muscle, skin and areas of the central nervous system. When prolactin binds to the receptor, it causes it to dimerize with another prolactin receptor. This results in the activation of Janus kinase 2, a tyrosine kinase that initiates the JAK-STAT pathway. Activation also results in the activation of mitogen-activated protein kinases and Src kinase. Human prolactin receptors are insensitive to mouse prolactin. Prolactin levels may be checked as part of a sex hormone workup, as elevated prolactin secretion can suppress the secretion of follicle stimulating hormone and gonadotropin-releasing hormone, leading to hypogonadism and sometimes causing erectile dysfunction. Prolactin levels may be of some use in distinguishing epileptic seizures from psychogenic non-epileptic seizures. The serum prolactin level usually rises following an epileptic seizure.
Oparin was born in Uglich in 1894 into a merchant family. He and his parents soon moved to Kokayevo, a nearby village. Oparin had an older brother, Dmitry, who became an economist. Oparin graduated from the Moscow State University in 1917 and became a professor of biochemistry there in 1927. Many of his early papers were about plant enzymes and their role in metabolism. His first experimental studies were devoted to the chemistry of respiration. In them, he showed that chlorogenic acid is an essential component of redox reactions in the cell. In 1924 he put forward a hypothesis suggesting that life on Earth developed through a gradual chemical evolution of carbon-based molecules in the Earth's primordial soup. In 1935, along with academician Aleksei Bach, he founded the Biochemistry Institute of the Soviet Academy of Sciences. In 1939, Oparin became a Corresponding Member of the Academy, and, in 1946, a full member. In 1937, he organized the Department of Technical Biochemistry at the Moscow Technological Institute of Food Industry. In 1940s and 1950s, Oparin supported the theories of Trofim Lysenko and Olga Lepeshinskaya, who made claims about "the origin of cells from noncellular matter". "Taking the party line" helped advance his career. However, according to cytologist Vladimir Alexandrov:
Amyloid beta can be measured semiquantitatively with immunostaining, which also allows one to determine location. Amyloid beta may be primarily vascular, as in cerebral amyloid angiopathy, or in amyloid plaques in white matter. One sensitive method is ELISA which is an immunosorbent assay which utilizes a pair of antibodies that recognize amyloid beta. Atomic force microscopy, which can visualize nanoscale molecular surfaces, can be used to determine the aggregation state of amyloid beta in vitro. Vibrational microspectroscopy is a label-free method that measures the vibration of molecules in tissue samples. Amyloid proteins like Aβ can be detected with this technique because of their high content of β-sheet structures. Dual polarisation interferometry is an optical technique which can measure early stages of aggregation by measuring the molecular size and densities as the fibrils elongate. These aggregate processes can also be studied on lipid bilayer constructs. TPM21 Sylvain Lesné – Aβ*56 Online Mendelian Inheritance in Man (OMIM): 104300
An analytical ultracentrifuge has a light source and optical detectors. To allow the light to pass through the analyte during the ultracentrifuge run, specialized cells are required which have to meet high optical standards as well as to resist the centrifugal forces. Each cell consists of a housing, two windows made from optically pure quartz glass, and a centrepiece with one or two sectors and filling holes for the sector(s), closed with a screw plug in the housing. These cell are placed into a rotor cavity with a continuous bore, with a collar at the bottom to retain the cell. By applying specific equipment and adapting measurement parameters several types of experiments can be performed. Most common AUC experiments are sedimentation velocity and sedimentation equilibrium experiments.
Sources: en.wikipedia.org
Work quickly in a dry environment and keep the container closed when not in use. Equilibrate sealed vials to room temperature before opening to reduce condensation. Record mass changes, as absorbed water can affect concentration calculations.
Liquid storage is generally shorter than dry storage because water enables hydrolysis, oxidation, and microbial growth. If solution storage is necessary, use sterile technique, appropriate pH, and cold temperatures. Aliquot to avoid repeated temperature changes.
Reversed-phase high-performance liquid chromatography is common for purity assessment, while mass spectrometry confirms molecular mass and can reveal modifications. Amino acid analysis or sequencing may be used when sequence information is critical. These methods complement visual inspection and storage records.
Multiple freezing and thawing events can cause aggregation, precipitation, or loss of soluble peptide. Dividing a solution into single-use aliquots before freezing reduces this risk. If multiple cycles are unavoidable, stability should be checked after thawing.