This is a working overview of Hydrolysis, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-04-12 and is reviewed periodically as new material appears.
Light exposure can damage aromatic residues and certain labels, so amber vials or opaque containers are often used. pH control matters in solution, as extreme acidity or alkalinity accelerates backbone cleavage; buffers may also introduce ions that affect solubility. Microbial growth is a concern for aqueous preparations that lack preservatives, though many research peptides are handled in sterile or low-bioburden conditions. Container materials can adsorb peptides, particularly hydrophobic or positively charged sequences, reducing recovery. These factors interact, meaning storage decisions balance chemical stability, physical state, and intended use.
Peptides are short chains of amino acids whose physical and chemical stability depends on sequence, length, and conformation. The amide backbone can hydrolyze under acidic or basic conditions, while side chains such as methionine, cysteine, and tryptophan are prone to oxidation. Aggregation may occur when hydrophobic regions associate, especially near surfaces or at high concentration. Because these pathways differ among peptides, no single storage condition applies to all sequences. Stability studies therefore examine each peptide under defined temperature, pH, and humidity ranges.
Reconstitution is often performed with sterile water, buffer, or a water-miscible organic solvent, depending on solubility. The solvent should be added gently along the vial wall, and the solution mixed by gentle swirling rather than vigorous vortexing, which can cause foaming and surface denaturation. Some sequences require a small amount of base or acid to dissolve, followed by pH adjustment. Preparing a concentrated stock solution can simplify later dilution, but the stock itself may have limited stability. Records of solvent, concentration, and date support reproducibility.
After reconstitution, dividing the solution into single-use aliquots limits multiple warming and cooling events and reduces contamination risk. Low-binding polypropylene tubes are often preferred because peptides can adsorb to glass or untreated plastic surfaces. Filling headspace with nitrogen or argon can slow oxidation, and amber or foil-wrapped containers reduce photodegradation. Each aliquot should be labeled with peptide identity, concentration, date, and storage conditions. Frozen aliquots should be thawed quickly and kept on ice until use.
| Property | Value | Notes |
|---|---|---|
| Appearance (lyophilized powder) | White to off-white powder | Color varies with sequence, counterion, and residual solvent. |
| Solubility | Aqueous or organic depending on sequence | Hydrophobic peptides may require organic co-solvents. |
| Typical storage temperature (dry) | -20 °C or lower | -80 °C is used for long-term archival storage. |
| Common analytical method | Reversed-phase HPLC | Purity and identity are assessed by retention time and peak area. |
| Common synonyms | Peptide, oligopeptide, polypeptide | Usage varies with chain length and context. |
Shipping and short-term transfer require attention to temperature control and physical stability. Frozen solutions are commonly sent on dry ice, while lyophilized powders may travel with gel packs or insulated packaging. Thawing should be done slowly on ice or in a refrigerator, not by vigorous heating, and the solution should be mixed gently before use. Temperature loggers can document excursions during transit, but their presence does not prove that a peptide remained stable. Analytical checks such as chromatography or mass spectrometry can verify identity and purity after storage or shipping.
Reconstitution begins with selecting a solvent that dissolves the peptide without causing degradation. Water or aqueous buffer is suitable for many hydrophilic sequences, while hydrophobic peptides may require a small amount of organic solvent such as acetonitrile or dimethyl sulfoxide before dilution. The solvent is added to the vial rather than the powder being scraped out, and the mixture is swirled or inverted gently to avoid foaming. Complete dissolution should be confirmed visually, and insoluble material may indicate aggregation or impurities. Because solvent tolerance varies, published solubility information or a small test dissolution can guide handling.
Moisture, oxygen, and light also affect peptide integrity. Lyophilized powders absorb water from the air, which can enable hydrolysis and conformational changes. Oxygen promotes oxidation of sensitive residues, so storage under inert gas or in sealed vials is common. Light exposure can cause photodegradation, particularly for peptides containing aromatic amino acids. Buffer choice and pH influence charge state and solubility; extremes of pH accelerate deamidation and hydrolysis. Adding stabilizers such as sugars or polyols can protect the peptide during freezing and drying. Optimal conditions are determined empirically for each peptide.
Peptides are short chains of amino acids that can undergo both chemical and physical degradation. Chemical pathways include hydrolysis of peptide bonds, oxidation of methionine or cysteine residues, deamidation of asparagine or glutamine, and isomerization of aspartate. Physical instability leads to aggregation, precipitation, or adsorption to surfaces. The rate of these processes depends on the peptide sequence, the formulation, and the storage environment. Because each peptide has a unique composition, no single storage condition applies to all peptides. Stability studies are therefore conducted to define suitable conditions for each specific molecule.
In aqueous solution, peptides are vulnerable to hydrolysis, oxidation, deamidation, and aggregation, with rates influenced by pH, temperature, buffer composition, and ionic strength. Acidic or neutral pH ranges often slow deamidation, while extreme pH can accelerate peptide bond cleavage. Dissolved oxygen and redox-active metal ions contribute to oxidation of methionine, cysteine, and tryptophan residues. Aggregation may be driven by hydrophobic interactions or by interfaces such as air-liquid and container surfaces. Because these pathways interact, solution storage usually requires tighter control than storage of dried material.
Temperature is the most common controlled variable, but its effect is not linear. Lower temperatures reduce most chemical reaction rates, yet freezing can concentrate solutes and create pH shifts in the remaining liquid phase. Repeated freeze-thaw cycles can denature or aggregate some peptides, especially those with hydrophobic segments. For lyophilized powders, desiccation and protection from moisture are often more important than deep freezing. For solutions, the choice between refrigeration and freezing depends on peptide concentration, buffer components, and the intended duration of storage.
Peptides are short chains of amino acids whose physical and chemical stability depends on sequence, length, conformation, and the surrounding matrix. In the solid state, lyophilized powders are generally more stable than solutions because low water activity slows hydrolysis and oxidation. Residual moisture, oxygen, trace metals, and light can still promote degradation over time. Storage recommendations therefore balance temperature, humidity, and container integrity rather than relying on a single condition. The optimal condition for a given peptide is often determined empirically because no universal rule covers every sequence.
Light, oxygen, and pH influence peptide integrity through specific side-chain reactions. Methionine and cysteine residues are susceptible to oxidation, and tryptophan can degrade under strong light. Inert gas overlays and amber glass or opaque containers reduce these risks. pH affects charge, solubility, and the rate of deamidation or aggregation; a value that minimizes one pathway may increase another. The optimal pH and buffer for a given peptide are often determined experimentally, and open questions remain about predicting stability from sequence alone.
Peptides are short chains of amino acids linked by amide bonds, and their storage stability depends on sequence, length, and three-dimensional structure. Chemical degradation can occur through hydrolysis, oxidation, deamidation, and aggregation, while physical changes such as precipitation or surface adsorption reduce recovery. Storage conditions are chosen to slow these processes without altering the peptide itself. Because peptides vary widely, no single condition suits every sequence, so laboratories often establish stability empirically for each batch.
Antibody–drug conjugates or ADCs are a class of bioconjugates and immunoconjugates. ADCs are composed of an antibody linked to a cytotoxic (anticancer) "payload" or drug. Among treatment options for cancer, chemotherapy is most widely used. Its main limitation is low target specificity. Unlike chemotherapy, ADCs target tumor cells while sparing healthy cells. As of 2019, some 56 pharmaceutical companies were developing ADCs. ADCs combine the targeting properties of monoclonal antibodies with the cancer-killing capabilities of cytotoxic drugs, designed to discriminate between healthy and diseased tissue.
The Department works at the intersection of organic chemistry (chemistry of natural products, chemistry of macrocyclic compounds, chemistry of elementorganic compounds), supramolecular chemistry (solution and self-process chemistry) and molecular biology. The head of the Department is Professor Igor S. Antipin, a corresponding member of the Russian Academy of Science, Doctor of Chemistry. The Department conducts research in the following fields:
Lewis acids have been classified in the ECW model and it has been shown that there is no one order of acid strengths. The relative acceptor strength of Lewis acids toward a series of bases, versus other Lewis acids, can be illustrated by C-B plots. It has been shown that to define the order of Lewis acid strength at least two properties must be considered. For Pearson's qualitative HSAB theory the two properties are hardness and strength while for Drago's quantitative ECW model the two properties are electrostatic and covalent. Monoprotic acids, also known as monobasic acids, are those acids that are able to donate one proton per molecule during the process of dissociation (sometimes called ionization) as shown below (symbolized by HA):
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Amyloid beta can be measured semiquantitatively with immunostaining, which also allows one to determine location. Amyloid beta may be primarily vascular, as in cerebral amyloid angiopathy, or in amyloid plaques in white matter. One sensitive method is ELISA which is an immunosorbent assay which utilizes a pair of antibodies that recognize amyloid beta. Atomic force microscopy, which can visualize nanoscale molecular surfaces, can be used to determine the aggregation state of amyloid beta in vitro. Vibrational microspectroscopy is a label-free method that measures the vibration of molecules in tissue samples. Amyloid proteins like Aβ can be detected with this technique because of their high content of β-sheet structures. Dual polarisation interferometry is an optical technique which can measure early stages of aggregation by measuring the molecular size and densities as the fibrils elongate. These aggregate processes can also be studied on lipid bilayer constructs. TPM21 Sylvain Lesné – Aβ*56 Online Mendelian Inheritance in Man (OMIM): 104300
Antibody–drug conjugates or ADCs are a class of bioconjugates and immunoconjugates. ADCs are composed of an antibody linked to a cytotoxic (anticancer) "payload" or drug. Among treatment options for cancer, chemotherapy is most widely used. Its main limitation is low target specificity. Unlike chemotherapy, ADCs target tumor cells while sparing healthy cells. As of 2019, some 56 pharmaceutical companies were developing ADCs. ADCs combine the targeting properties of monoclonal antibodies with the cancer-killing capabilities of cytotoxic drugs, designed to discriminate between healthy and diseased tissue.
AlphaKnot complements KnotProt, a database focused on experimentally determined protein structures and their topological features. KnotProt provides detailed descriptions of knots, slipknots, and related entanglements in experimentally characterized proteins, whereas AlphaKnot was developed primarily to examine the much larger population of structures generated by modern protein-structure prediction methods. AlphaKnot has been used to investigate the frequency and distribution of knots in protein families and to identify previously uncharacterized topological architectures. Large-scale analyses of AlphaFold structures have identified unusual knot types and proteins containing multiple knots, while comparison with experimentally determined structures has provided examples in which unusual predicted topologies were subsequently confirmed experimentally. The database can therefore be used both as a source of candidate knotted proteins for experimental investigation and as a computational tool for examining the relationship between protein sequence, structure, and topology.
Because their backbones are longer than those of normal peptides, β-peptides form disparate secondary structures. The alkyl substituents at both the α and β positions in a β-amino acid favor a gauche conformation about the bond between the α-carbon and β-carbon. This also affects the thermodynamic stability of the structure. Many types of helix structures consisting of β-peptides have been reported. These conformation types are distinguished by the number of atoms in the hydrogen-bonded ring that is formed in solution; 8-helix, 10-helix, 12-helix, 14-helix, and 10/12-helix have been reported. Generally speaking, β-peptides form a more stable helix than α-peptides. β-Peptides are stable against proteolytic degradation in vitro and in vivo, a potential advantage over natural peptides. β-Peptides have been used to mimic natural peptide-based antibiotics such as magainins, which are highly potent but difficult to use as drugs because they are degraded by proteolytic enzymes.
In addition to regulating the experiments that were conducted, the guidelines also forbade the performance of other experiments. One such experiment was the cloning of recombinant DNAs derived from highly pathogenic organisms. In addition, neither the cloning of DNA containing toxin genes nor large-scale experiments using recombinant DNAs that were able to make products that were potentially harmful to humans, animals, or plants were allowed under the guidelines. These experiments were banned because the potential biohazards could not be contained by the then-current safety precautions.
Sources: en.wikipedia.org
Subject of research: synthesis of organophosphorous and organoelement compounds, study of their spatial and electronic structure, intramolecular electronic interactions, reaction capacity and mechanism of reactions. Arkady N. Pudovik corresponding member of Russian Academy of Science worked at this department since its opening (1948) until his death (February 2006) he was the founder of the department of High Molecular and Organoelement Compounds and held the position of Head of department until 1987. Current head of the Department – Corresponding Member of the Academy of Sciences of the Republic of Tatarstan, Professor Vladimir I. Galkin, doctor of Science in chemistry. The Department conducts research in the following fields:
Ketone bodies can be used as fuels, yielding 22 ATP and 2 GTP molecules per acetoacetate molecule when oxidized in the mitochondria. Ketone bodies are transported from the liver to other tissues, where acetoacetate and beta-hydroxybutyrate can be reconverted to acetyl-CoA to produce reducing equivalents (NADH and FADH2), via the citric acid cycle. Ketone bodies cannot be used as fuel by the liver, because the liver lacks the enzyme β-ketoacyl-CoA transferase, also called thiolase. Acetoacetate in low concentrations is taken up by the liver and undergoes detoxification through the methylglyoxal pathway which ends with lactate. Acetoacetate in high concentrations is absorbed by cells other than those in the liver and enters a different pathway via 1,2-propanediol. Though the pathway follows a different series of steps requiring ATP, 1,2-propanediol can be turned into pyruvate.
Discovered by Tillett and Francis in 1930, it was initially thought that CRP might be a pathogenic secretion since it was elevated in a variety of illnesses, including cancer. The later discovery of hepatic synthesis (made in the liver) demonstrated that it is a native protein. Initially, CRP was measured using the quellung reaction which gave a positive or a negative result. More precise methods nowadays use dynamic light scattering after reaction with CRP-specific antibodies. CRP was so named because it was first identified as a substance in the serum of patients with acute inflammation that reacted with the cell wall polysaccharide (C-polysaccharide) of pneumococcus.
Alemtuzumab, sold under the brand names Campath and Lemtrada among others, is a medication used to treat chronic lymphocytic leukemia and multiple sclerosis. In chronic lymphocytic leukemia, it has been used as both a first line and second line treatment. It is given by injection into a vein. It is a monoclonal antibody that binds to CD52, a protein present on the surface of mature lymphocytes, but not on the stem cells from which these lymphocytes are derived. After treatment with alemtuzumab, these CD52-bearing lymphocytes are targeted for destruction. Alemtuzumab was approved for medical use in the United States in 2001. (Mab)Campath was withdrawn from the markets in the US and the EU in 2012, to prepare for a higher-priced relaunch of Lemtrada aimed at multiple sclerosis. Alemtuzumab is used for the treatment of B-cell chronic lymphocytic leukemia in people who have been treated with alkylating agents and who have failed fludarabine therapy. It is an unconjugated antibody, thought to work via the activation of antibody-dependent cell-mediated cytotoxicity.
P-glycoprotein (3.A.1.201.1) is a well-studied protein associated with multi-drug resistance. It belongs to the human ABCB (MDR/TAP) family and is also known as ABCB1 or MDR1 Pgp. MDR1 consists of a functional monomer with two transmembrane domains (TMD) and two nucleotide-binding domains (NBD). This protein can transport mainly cationic or electrically neutral substrates as well as a broad spectrum of amphiphilic substrates. The structure of the full-size ABCB1 monomer was obtained in the presence and absence of nucleotide using electron cryo crystallography. Without the nucleotide, the TMDs are approximately parallel and form a barrel surrounding a central pore, with the opening facing towards the extracellular side of the membrane and closed at the intracellular face. In the presence of the nonhydrolyzable ATP analog, AMP-PNP, the TMDs have a substantial reorganization with three clearly segregated domains. A central pore, which is enclosed between the TMDs, is slightly open towards the intracellular face with a gap between two domains allowing access of substrate from the lipid phase. Substantial repacking and possible rotation of the TM helices upon nucleotide binding suggests a helix rotation model for the transport mechanism.
Sources: en.wikipedia.org
Freezing slows hydrolysis and oxidation by reducing molecular motion and available water. Lyophilized powders contain little moisture, so they can remain stable for extended periods when kept cold and dry. The exact temperature depends on peptide sequence and expected storage duration.
Solutions generally degrade faster because water participates in hydrolysis and enables aggregation or microbial growth. Buffer composition, pH, and concentration influence the rate. For this reason, many procedures prepare solutions shortly before use and avoid long-term liquid storage.
Ice crystal formation and concentrated solutes can stress peptide molecules and promote aggregation. Repeated cycling also exposes the sample to temperature fluctuations that may accelerate degradation. Aliquoting before freezing reduces the number of cycles a single container experiences.
Dividing a stock into single-use portions usually reduces multiple thawing and refreezing events and lowers contamination risk. It also allows a needed amount to be removed without warming the entire supply.